Protein Info for IAI46_23665 in Serratia liquefaciens MT49

Annotation: nitrite transporter NirC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 14 to 247 (234 residues), 201.1 bits, see alignment E=9.2e-64 TIGR00790: formate/nitrite transporter" amino acids 20 to 250 (231 residues), 267.3 bits, see alignment E=6.1e-84

Best Hits

Swiss-Prot: 85% identical to NIRC_SALTY: Nitrite transporter NirC (nirC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_4689)

MetaCyc: 86% identical to nitrite transporter NirC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-137

Predicted SEED Role

"Nitrite transporter NirC" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>IAI46_23665 nitrite transporter NirC (Serratia liquefaciens MT49)
MFTDTINKCAANAARIVRLAKHSPLGFWISSAMAGAYVGLGIILIFTLGNLVDPSLRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTITQGQMWAVLPQTWLGNLLGSVLVA
LMYYYGGGSLLPVDTSLVHTAALAKTTAPAEVLFFKGVLCNWLVCLAIWMAIRVEGAAKF
IAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSEAYTLSGIGHNLLWVTLGNILSGSVL
MGLGYWYATPRAERPQAEKAVTRQAA