Protein Info for IAI46_23645 in Serratia liquefaciens MT49

Annotation: MFS transporter TsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 76 to 92 (17 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 321 (307 residues), 84 bits, see alignment E=5.1e-28

Best Hits

Swiss-Prot: 98% identical to TSGA_SERP5: Protein TsgA homolog (tsgA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K06141, MFS transporter, TsgA protein (inferred from 98% identity to srs:SerAS12_4686)

Predicted SEED Role

"TsgA protein homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>IAI46_23645 MFS transporter TsgA (Serratia liquefaciens MT49)
MNDSNRLRLTWISYFSYALTGALVIVTGMVMGNIAEYFNLPVSSMSNTFTFLNAGILISI
FLNAWLMEIIPLKRQLMFGFVLMVLAVAGLMVGKSLTMFSLCMFVLGVVSGITMSIGTFL
ITHMYAGRQRGSRLLFTDSFFSMAGMIFPIVAAMLLARQIGWYWVYACIGLLYVGIFVLT
LFSEFPVLGNKGADAGQPVAKEKWGIGVLFLSIAALCYILGQLGFIQWVPEYATKSFGMD
ISQAGKLVSDFWTSYMVGMWVFSFILRFFDLQRIVTILAALATGAMYMFVSTDNPEHLGY
YIMALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGTIGTMLTFVVTGPIVAKGGAH
AALTTANGLYLAVFVMCLLLGFVTKHRSHGHVTH