Protein Info for IAI46_23620 in Serratia liquefaciens MT49

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 109 to 120 (12 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 28 to 196 (169 residues), 193 bits, see alignment E=3e-61 PF06580: His_kinase" amino acids 371 to 448 (78 residues), 87.3 bits, see alignment E=6.7e-29

Best Hits

Swiss-Prot: 72% identical to BTSS_ECOLI: Sensor histidine kinase BtsS (btsS) from Escherichia coli (strain K12)

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 97% identity to srs:SerAS12_4681)

MetaCyc: 72% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>IAI46_23620 sensor histidine kinase (Serratia liquefaciens MT49)
MFEFSQVLLLLQQMCVYLVIAYLLSKTPLFIPLTQVTIRLPHKLLCYVIFSVFCIMGTYF
GLHVEGSIANTRAIGAVLGGLLGGPSVGFLVGLTGGLHRYTLGGMTDIACAVSTVAEGLV
GGLVHSIAMRRRRIDLLFNPLFVAGVALVTEVLQMAIILAIARPFDEALRLVEHIALPML
IANTLGAAMFMQILLDRRAMFEKYTGAFSAKALKIAERTEGILRQGFDQENSMRVARVLY
QELGIGAVAITDREKLLAFIGIGDDHHLPGTPISSKHSHRAIDNNEVVYADGNELSYSCS
INANCKLGSTLVIPLRGENQRVIGTIKLYEPKSRLFSTINRTLGEGIANLLSAQIMAGQY
ERHTQLLAQSEIKLLHAQVNPHFLFNALNTLVAVIRRDGDRACELVQYLSTFFRKNLKRS
DDEVSLADELEHVNAYLQIEQARFADRLEIAVSLPEELLAVRLPAFSLQPIVENAIKHGT
SQLLGIGRIDIGARLEDGCLLLQVTDNAGLYQPLPNNSGLGMNLVDKRIRVRYGDGYGVR
VACEPQTFTRITLNVPLARAA