Protein Info for IAI46_23615 in Serratia liquefaciens MT49

Annotation: two-component system response regulator BtsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 89.9 bits, see alignment E=1.2e-29 PF04397: LytTR" amino acids 144 to 237 (94 residues), 75.6 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 66% identical to BTSR_SALTY: Transcriptional regulatory protein BtsR (btsR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 99% identity to spe:Spro_4587)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI46_23615 two-component system response regulator BtsR (Serratia liquefaciens MT49)
MLNVLIVDDEPSARDNLRHLLEAEEGISIVGECANAIEAISGIHRLQPDVVFLDIQMPRI
TGLEMVGMLDPNRMPHIVFLTAYDEYAVQAFEEHAFDYLLKPAEPKRLSKTLQRLQQQRG
QQNIAALDESAGYLKYIPCTGHSRIYLLRFDEVVAIRSRLSGVFVVRNDGMECFTELTLR
TLELRTPLVRCHRQYLVNLEQVREIRFDEGGAAEMIMPVGEPVPVSRRYLKALKEELGLR
G