Protein Info for IAI46_23570 in Serratia liquefaciens MT49

Annotation: phosphoribulokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00485: PRK
  • amino acids 7 to 214 (208 residues), 237.5 bits, E=5.7e-75

Best Hits

Swiss-Prot: 89% identical to KPPR_SHIFL: Probable phosphoribulokinase (prkB) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_4670)

Predicted SEED Role

"Phosphoribulokinase (EC 2.7.1.19) homolog, function unknown" in subsystem Calvin-Benson cycle (EC 2.7.1.19)

MetaCyc Pathways

• Rubisco shunt (9/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.19

Protein Sequence (289 amino acids)

>IAI46_23570 phosphoribulokinase (Serratia liquefaciens MT49)
MSAKHPVIAVTGSSGAGTTTTSVAFRKIFQQLNIRAAELEGDSFHRYTRPEMDAAIRKAR
DLGRHISYFGPEANDFGLLQQSFLDYGKNGTGRSRKYLHTYDEAVPYNQVPGTFTPWEAL
PAPTDVLFYEGLHGGVVTEHIDVAKHVDLLVGVVPIVNLEWIQKLIRDTGERGHSREAVM
DSVVRSMEDYINYITPQFSRTHINFQRVPTVDTSNPFAAKAIPSLDESFVVIHFRGLDQI
DFPYLLAMLQGSFISHINTLVVPGGKMGLAMELIMAPLVQRLLEGKKIE