Protein Info for IAI46_23545 in Serratia liquefaciens MT49

Annotation: taurine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13379: NMT1_2" amino acids 27 to 239 (213 residues), 63.2 bits, see alignment E=8.7e-21 PF04069: OpuAC" amino acids 27 to 234 (208 residues), 89.9 bits, see alignment E=5.6e-29 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 28 to 323 (296 residues), 455.4 bits, see alignment E=4.8e-141 PF12974: Phosphonate-bd" amino acids 43 to 224 (182 residues), 36.5 bits, see alignment E=9.8e-13 PF09084: NMT1" amino acids 47 to 244 (198 residues), 70.8 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 75% identical to TAUA_ECOLI: Taurine-binding periplasmic protein (tauA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 96% identity to srs:SerAS12_4666)

MetaCyc: 75% identical to taurine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>IAI46_23545 taurine ABC transporter substrate-binding protein (Serratia liquefaciens MT49)
MASKLFALRSAVLLALSLGTASAYAVDVTVAYQTSAEPAKVAQAENSFAKQSGATVDWRK
FDSGSSVLRALASGDVQIGNIGSSPLAVAASQKLPIEVFLIASQLGSSEALVVKKEIKSP
QDLIGKRIAVPFISTTHYSLLASLKHWGIKPEQVKILNLQPPAIAAAWQRGDIDGAYVWA
PVVNELAKQGKVLTDSAQVGQWGAPTLDVWVVRKDFAEKHPEVVTAFAASALNAQKAYLA
QPEQWLKDKGNLSTLSRLSGVPEEQIPVLVQGNTYLPVAEQITQLGQPVDKAIHDTAEFL
KQQGKIPQVDSDYSAYVTDRFVKQVQAAPQS