Protein Info for IAI46_23535 in Serratia liquefaciens MT49

Annotation: taurine ABC transporter permease TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 270 (170 residues), 93.3 bits, see alignment E=8.1e-31

Best Hits

Swiss-Prot: 81% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 97% identity to spe:Spro_4564)

MetaCyc: 81% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>IAI46_23535 taurine ABC transporter permease TauC (Serratia liquefaciens MT49)
MSLHSALKEVAQPKAAAPRRFSVPRNVWLSSTTLLVVLAIWWGVTALNLISPLFLPAPQQ
VLHQLITIASPQGFMDATLWQHLAASLGRILVALLAAVIIGVPVGIAMGLNDTVRGILDP
LIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVTLSAVAGVRSVAQVRVRAAR
ALGANRWQVLRFVVLPSALPEILTGIRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFL
ATDVVLAGIGVIAIIAFGLELGLRALQRRLTPWHGVQQ