Protein Info for IAI46_23520 in Serratia liquefaciens MT49

Annotation: glutathione-regulated potassium-efflux system ancillary protein KefG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF02525: Flavodoxin_2" amino acids 6 to 172 (167 residues), 155.8 bits, see alignment E=5.9e-50

Best Hits

Swiss-Prot: 99% identical to KEFG_SERP5: Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_4660)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>IAI46_23520 glutathione-regulated potassium-efflux system ancillary protein KefG (Serratia liquefaciens MT49)
MSQPPKVLLLYAHPESQDSVANRVLLRPAQQLEHVTVHDLYAHYPDFFIDIHHEQQLLRE
HQVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGMGGNALAGKYWRSVITTGEPEGAYRT
GGYNRYPMEDILRPFELTAAMCHMHWLTPMLVYWARRQKPEVLENHATAYGDWLRNPLPH
GGR