Protein Info for IAI46_23485 in Serratia liquefaciens MT49

Annotation: sulfurtransferase complex subunit TusD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF02635: DsrE" amino acids 1 to 128 (128 residues), 91.5 bits, see alignment E=2.3e-30 TIGR03012: sulfur relay protein TusD/DsrE" amino acids 2 to 128 (127 residues), 180.3 bits, see alignment E=6.4e-58

Best Hits

Swiss-Prot: 91% identical to TUSD_SERP5: Sulfurtransferase TusD (tusD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 91% identity to spe:Spro_4554)

MetaCyc: 76% identical to sulfurtransferase complex subunit TusD (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>IAI46_23485 sulfurtransferase complex subunit TusD (Serratia liquefaciens MT49)
MNYCLLVTGPAYGTQQASSAYQFAQALLVKGHRLSSVFFYREGVLNANQLTAPASDEFDL
VRGWVQLAQEHGIELNVCVAAALRRGVTDEQEAAQQGLPSANLQPGFTLSGLGSLAEASL
SCDRLVQF