Protein Info for IAI46_23480 in Serratia liquefaciens MT49

Annotation: sulfurtransferase complex subunit TusC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02635: DsrE
  • amino acids 2 to 119 (118 residues), 98.8 bits, E=1.2e-32
• TIGR03010: sulfur relay protein TusC/DsrF
  • amino acids 4 to 119 (116 residues), 156.4 bits, E=1.3e-50

Best Hits

Swiss-Prot: 90% identical to TUSC_SERP5: Protein TusC (tusC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07236, tRNA 2-thiouridine synthesizing protein C (inferred from 90% identity to srs:SerAS12_4652)

MetaCyc: 63% identical to sulfurtransferase complex subunit TusC (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusC"

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)

Protein Sequence (119 amino acids)

>IAI46_23480 sulfurtransferase complex subunit TusC (Serratia liquefaciens MT49)
MKRVAFVFTQSPHGSASGREGLDALLATSALSEDLGVFFIGDGVLQIMPGQQPEKILARN
YIATFGVLPLYDVEQCYLCQASLQERGLSQVTDWVLDAEILAPDALSRQLASYDMVMTF