Protein Info for IAI46_23470 in Serratia liquefaciens MT49

Annotation: 30S ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 124 (124 residues), 231.7 bits, E=7.2e-74
• PF00164: Ribosom_S12_S23
  • amino acids 13 to 123 (111 residues), 145.6 bits, E=2.3e-47

Best Hits

Swiss-Prot: 100% identical to RS12_SERP5: 30S ribosomal protein S12 (rpsL) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 96% identity to ecv:APECO1_3111)

MetaCyc: 96% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Protein Sequence (124 amino acids)

>IAI46_23470 30S ribosomal protein S12 (Serratia liquefaciens MT49)
MATINQLVRKPRSVKAAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
KPKA