Protein Info for IAI46_23275 in Serratia liquefaciens MT49

Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 7 to 127 (121 residues), 96 bits, E=7.3e-31
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 8 to 428 (421 residues), 584.8 bits, E=6.6e-180
• PF01189: Methyltr_RsmB-F
  • amino acids 241 to 426 (186 residues), 257.9 bits, E=1.9e-80
• PF13847: Methyltransf_31
  • amino acids 246 to 381 (136 residues), 38.4 bits, E=3.3e-13
• PF01728: FtsJ
  • amino acids 246 to 390 (145 residues), 30.7 bits, E=8.9e-11
• PF13649: Methyltransf_25
  • amino acids 250 to 321 (72 residues), 29.8 bits, E=2.4e-10

Best Hits

Swiss-Prot: 96% identical to RSMB_SERP5: Ribosomal RNA small subunit methyltransferase B (rsmB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 96% identity to spe:Spro_4513)

MetaCyc: 72% identical to 16S rRNA m5C967 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11591 [EC: 2.1.1.176]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Protein Sequence (429 amino acids)

>IAI46_23275 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Serratia liquefaciens MT49)
MKNNYNLRSIAAKAIGQVLDQGQSLSTVLPPLQKSISDKDRALLQELCFGTLRVLPQLEW
CIQQLMAKPMTGKQRTLHYLLMVGLYQLLYTRIPAHAVLAETVEGAVALKRPQLKGLING
VLRQFQRQQEELLQRAANNDSRYLHPSWLLKRIQQAYPAQWEQIVDANNQKPPMWLRVSR
LHHTREDYLQLMAQAGIAAEPHTEYRDAIRLLAPCAVTDLPGFADGWVTVQDASAQGCVD
LLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLSRVKENLQRLRLHAEIK
QGDGRTPQDWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAALQAEIIEAI
WPHLKKGGVMVYATCSILPAENAEQITAFLQRHPEARLVETGDEQQPGRQNLPHPEDGDG
FFYAKLIKM