Protein Info for IAI46_23170 in Serratia liquefaciens MT49

Annotation: gluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 103 to 132 (30 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 383 to 407 (25 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 5 to 443 (439 residues), 492.7 bits, see alignment E=5.5e-152 PF02447: GntP_permease" amino acids 5 to 441 (437 residues), 481.3 bits, see alignment E=2.8e-148 PF03600: CitMHS" amino acids 18 to 390 (373 residues), 46.4 bits, see alignment E=3.1e-16

Best Hits

Swiss-Prot: 72% identical to GNTU_ECOLI: Low-affinity gluconate transporter (gntU) from Escherichia coli (strain K12)

KEGG orthology group: K06156, Gnt-I system low-affinity gluconate transporter (inferred from 98% identity to spe:Spro_4498)

MetaCyc: 72% identical to low-affinity gluconate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-209

Predicted SEED Role

"Low-affinity gluconate/H+ symporter GntU" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>IAI46_23170 gluconate transporter (Serratia liquefaciens MT49)
MNTVTLVGTAVGSVLLLLFLVMKARMHAFVALMLVSIAAGIFSGMPLDRIADTMQKGMGD
TLGFLAIVVALGAMFGKILHEVGALDQIAAHLLKRFGQSKAHYALGIAGLICALPLFFDV
AVVLLIGIVFAVARRTDGNIVKLAIPLFAGVAAAASFLLPGPVPMLLAAQMKADFGWMIA
IGLVAAVLGMLIAGPLYGSFISHFVNWPMPADENEPTLNKGNLPSFGFSLALVLCPLVLV
GMKTIGARLVTPGSQLQQWLEFIGHPFTAILIACLIVIYGLAKPRGMTNEQTLAICSAAV
QPAGIILLMTGAGGVFKQILVDSGVGPALGDAMIGTGLPIAVAAFALSAMVRVIQGSATV
ACLTTVGLVLPVTSQLGLGGGQLAALAICIAGGSIVLSHVNDAGFWLFGKFTGANELQTL
KTWTVMETILGSVGGIIGMIAFTLF