Protein Info for IAI46_23160 in Serratia liquefaciens MT49

Annotation: glyoxylate bypass operon transcriptional repressor IclR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09339: HTH_IclR
  • amino acids 29 to 79 (51 residues), 67.9 bits, 5.2e-23
• PF01614: IclR
  • amino acids 148 to 270 (123 residues), 137.9 bits, E=1.9e-44

Best Hits

Swiss-Prot: 77% identical to ICLR_ECOLI: Transcriptional repressor IclR (iclR) from Escherichia coli (strain K12)

KEGG orthology group: K13641, IclR family transcriptional regulator, acetate operon repressor (inferred from 98% identity to spe:Spro_4491)

Predicted SEED Role

"Acetate operon repressor"

Protein Sequence (276 amino acids)

>IAI46_23160 glyoxylate bypass operon transcriptional repressor IclR (Serratia liquefaciens MT49)
MVTPVPAKRGKKPRAASPSASAATGQVQSLTRGLKLLEYIAEAQGNVALTDLAQQAGLPN
STTHRLLSTMQQQGFVRQVGDLGLWTIGSHAFVVGSSFLQSRNLLAMVHPTLRRLMEESG
ETVNLAVLDTSEYQAIIIDQVQCTALMRMSAPIGGKLPMHASGAGKAFLSTLPDDQVTKL
LHKKGMQTYTQHTLTPHNLKEGLAQIRKQGFSFDDEEHALGLRCVAACIFDEHREAFAAI
SISGPVSRITDNRVIELGALVIHAAKEISLEYGGVR