Protein Info for IAI46_23135 in Serratia liquefaciens MT49

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 65 to 84 (20 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 272 (183 residues), 46.5 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to srs:SerAS12_4589)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>IAI46_23135 ABC transporter permease subunit (Serratia liquefaciens MT49)
MKAKWIAALCLLPFILLFGAFQIAPLVWIAVSSFFSQTSGWGLGNYVDVLTSPFYLQAFQ
FSLEISLWSSVYGLLIALVGSYSLRRLGQTRFHDFVMSFTNMTSNFAGVPLAFAFVILLG
LNGCLTLLLRKYGLMESFNLYSKTGLIVLYTYFQIPLGVLLLYPAFDALREDWRESASLL
GASPWRYWRHIGLPVLAPALMGTFVILLANALGAYATVYALTTGNFNVIPIRISALVAGD
ISLDPNLASALAMLLVVMMAFITLIHQWLLRRSYLNARS