Protein Info for IAI46_23130 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 62 to 91 (30 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 258 (171 residues), 51.2 bits, see alignment E=6.5e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to spe:Spro_4485)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>IAI46_23130 ABC transporter permease (Serratia liquefaciens MT49)
MSRFETGYHRVVSGLLLLILLLPLAATLIYALATQWGATILPDGFTLKWLVALWSDPRFL
LALWHSLLICFGTLVLAVVVILPTMFVIAYYFPKLDAVMNVLILLPFAVPPVVSAVGLMQ
LFAADPLPLLGTPWILIGCYFSITLPFIYRAISNNMQAINLRDLMDAAHLLGASTWQAAL
LVVLPNLRKGGMIAVLLSFSFLIGEFVFANLLVGSQYETLQVYLYNMRNGSGHFTSALVI
SYFAVVLIVTWLANLLNKNKG