Protein Info for IAI46_23110 in Serratia liquefaciens MT49

Annotation: ShlB/FhaC/HecB family hemolysin secretion/activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08479: POTRA_2" amino acids 79 to 152 (74 residues), 63.2 bits, see alignment E=2.3e-21 PF17287: POTRA_3" amino acids 154 to 204 (51 residues), 51.2 bits, see alignment 1e-17 PF03865: ShlB" amino acids 209 to 520 (312 residues), 315.8 bits, see alignment E=5.9e-98

Best Hits

Swiss-Prot: 76% identical to HLYB_SERMA: Hemolysin transporter protein ShlB (shlB) from Serratia marcescens

KEGG orthology group: K11017, hemolysin activation/secretion protein?? (inferred from 91% identity to spe:Spro_4481)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>IAI46_23110 ShlB/FhaC/HecB family hemolysin secretion/activation protein (Serratia liquefaciens MT49)
MIRKTAALALLFSTALPAATLPEMGGFSPMSESRRALQDGTREVNQQIEQRRYQQLKQQQ
LLEDPEPAAPALPLSAQCLPIGGVYLQGITLLSAKDLATLSALPEHCISSNDINRLTREL
TRLYLDKGYITARVQFIRPNAEGELGLRVTEGFIEKIEGGDRWVNSQLLFPGLEGQPLKL
TQLDQGLDQANRLQSNKTRLDILPGSKVGASIIRLHNQHTKPWLLSATVDNYGQKNTGQW
LARSTATLDSPFGLSDFASLNVAGTLDNPAQRYNRAYTLLYSLPYGAFTFSGFASYSQYL
NHQQLVFNSYKLHGQTQQYGLRGDYVFYRDRDQINTLNGQLTHKRITNYFETVRIGLGSP
TLSLFELGVNHLQILPTGLISANLSVEQGLPWFGADRQKGAGLPDAQFTKGKLFVNLNQR
LQLAGATYQLSNLLYGQYSRERLPGVEWLSLTDRSAIRGFSRSTLSGDNGWYLQNTLSRS
FTLGQSSLTPRIGGDVGRVLPRDNRPSGWQSSAGLSAGVTLRYQRAMFDVEASRGWLLSS
HSMPDDPIQVLARFSYTF