Protein Info for IAI46_23105 in Serratia liquefaciens MT49

Annotation: ketopantoate/pantoate/pantothenate transporter PanS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 270 to 271 (2 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 246 (233 residues), 75.2 bits, see alignment E=6.1e-25 PF01758: SBF" amino acids 36 to 213 (178 residues), 147.5 bits, see alignment E=4e-47

Best Hits

Swiss-Prot: 83% identical to PANS_SALTY: Pantothenate precursors transporter PanS (panS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 97% identity to spe:Spro_4480)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>IAI46_23105 ketopantoate/pantoate/pantothenate transporter PanS (Serratia liquefaciens MT49)
MLAKFTRLFPLWAVLLAVAAYSTPTTFTGIGPYVSPLLMLIMFAMGVTLRLDDFKRVLSR
PGPVAAGIFLHYLIMPLAAWLLAMLFHMPPDLSAGMVLVGSVASGTASNVMIYLAKGDVA
LSVTISAVSTLVGVFATPLLTRLYVDTEISVDVMGMLLSILQIVVIPIGLGLIVHHTFTK
TVKRIEPILPALSMICILAIISAVVAGSQSHIASVGLVVIVAVILHNGIGLLSGYWGGKL
FGFDESTCRTLAIEVGMQNSGLAATLGKIYFSPLAALPGALFSVWHNLSGSLLAGYWSGR
PITKK