Protein Info for IAI46_23095 in Serratia liquefaciens MT49

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 245 to 261 (17 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 10 to 390 (381 residues), 146.3 bits, see alignment E=1.2e-46 PF02254: TrkA_N" amino acids 402 to 494 (93 residues), 30.5 bits, see alignment E=4e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_4478)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>IAI46_23095 sodium:proton antiporter (Serratia liquefaciens MT49)
MELSAPLMLVVIGLSSLLAQWLAWVLRLPAILPLLVFGIVLGPVVHWVQPDALFGDLLFP
LVSLSVAIILFEGALTLRVEEIRGLGGVVRNLVTIGMLMTFLVIGVACWWLLDFPPELAA
LIGAVTVVTGPTVIAPLMRVVRPNANINQVLRWEGIVIDPVGAIFTLLVFEFIVLKQHSE
SYTHLFWTLGITAAVGLVAGALFGYLLGLALRRVWLPRYLQNLAVLAIMLTAFGVSNAIA
DESGLLTVTVMGIWLANMRDVDTSDILAFKEELSAILISALFIILAARLDIQALWNMGWP
LLGLLLVVQFVARPLCIAVSTWRSSLHWRDRLLLCWIAPRGIVAAAVSSLFALTLQRSGY
PGADRLVTVVFAVIIGTVVLQSLTSGMMARWLRVQQQKPRGVLIVGANSVARMLAQALMK
LNIPVLVTDSSWEYYRQARMDGIPAYYGHAYSEHAENYLDLSDTAQVLALSPNRHQNALA
VYHFGHIFGEGQVFAIRSGAPLKGRGNSAESSRFRRHEILFNQEATYGRLSSLIAQGATI
KATKLNENFGWLEYIEKNHGVIPLFSQREDGTLQPIGAGFVPAMPCTLIALVQDENPSTS
GR