Protein Info for IAI46_23050 in Serratia liquefaciens MT49

Annotation: maltoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02264: LamB
  • amino acids 28 to 431 (404 residues), 440.8 bits, E=4.1e-136

Best Hits

Swiss-Prot: 93% identical to LAMB_SERP5: Maltoporin (lamB) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_4571)

MetaCyc: 75% identical to maltose outer membrane channel / phage lambda receptor protein (Escherichia coli K-12 substr. MG1655)
RXN0-1741; RXN0-1804

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Protein Sequence (431 amino acids)

>IAI46_23050 maltoporin (Serratia liquefaciens MT49)
MMTTLRKLPLALAIAAGVLTTQAMAVDFKGYARSGIGWTGSGGEQQCFQATGAGSKYRLG
NECETYAELKLGQEVWKEGDKSFYFDTNLAYSVSQRSDFESVSPGFREVNVQGKNLIEWL
PGANMWAGKRFYQRHDVHMIDFYYWDISGPGAGLENIDLGFGKLSAAVTRNSESGGSYGY
LDNEWDQRPTVNDTFDVRLAGLELNPGGTLELGVDYGRANTQDGYHLADGASKDGWMFTA
EHTQSILTGYNKFVVQYATDSMTSQNNGRNQGSTIDNNGKMIRVLDHGAIDFNDQWALMY
VGMFQDVDRDNNNGTTWYTVGVRPMYKWTPIMSTLLEAGYDNVKSQRTGDRNGQYKVTLA
QQWQAGNSIWSRPAIRVFATYAKWDEKWGYANNDSGAGYTSGTAYNDTSLHTFSRGNDDE
VTFGAQMEIWW