Protein Info for IAI46_23035 in Serratia liquefaciens MT49

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00356: LacI" amino acids 13 to 56 (44 residues), 46.7 bits, see alignment 4.5e-16 PF00532: Peripla_BP_1" amino acids 68 to 275 (208 residues), 110.8 bits, see alignment E=1.8e-35 PF13407: Peripla_BP_4" amino acids 71 to 283 (213 residues), 66.5 bits, see alignment E=5.7e-22 PF13377: Peripla_BP_3" amino acids 176 to 331 (156 residues), 111.2 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 93% identity to spe:Spro_4466)

Predicted SEED Role

"Transcriptional regulator CKO_02662, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>IAI46_23035 LacI family DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MDNQSARRITRADVARVAGTSVAVVSYVINNGPRPVAEATRLRVLEAIEKTGYRPNDIAR
ALASGNTLTYGLVVPDISNPFFATLAQALQREAFSHGRVLLLGDAGDDRQREHDLINHLL
RRQVDGLLYTSVDRHPWFDLIRASGTPCVMIDTIDSHAGVCAIRVDERDAACQATRHLLQ
HGYQDIGIFVGPLTMLNAQDRLNGWRDALKEAGIAPREEWIFEAPYTRQGGYQASQKMLQ
APRPRAIFTSNEQQALGCLSALAEHRLRVPDDLAIICFNGTQQSEFSVPPLSAVEQPIDA
MAKRAIAMLAAGAAQPELHEFAFQLHIRRSCGC