Protein Info for IAI46_23000 in Serratia liquefaciens MT49

Annotation: MATE family efflux transporter DinF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 21 to 414 (394 residues), 325.7 bits, see alignment E=2e-101 PF01554: MatE" amino acids 21 to 181 (161 residues), 115.9 bits, see alignment E=7.8e-38 amino acids 245 to 401 (157 residues), 48.2 bits, see alignment E=5e-17

Best Hits

Swiss-Prot: 77% identical to DINF_ECOLI: DNA damage-inducible protein F (dinF) from Escherichia coli (strain K12)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 96% identity to spe:Spro_4459)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>IAI46_23000 MATE family efflux transporter DinF (Serratia liquefaciens MT49)
MRLLSAFTSDTDKALWRLALPMIFSNITVPLLGLVDTAVIGHLDSPVYLGGVAVGAMATS
FLFMLLLFLRMSTTGLTAQALGAQNPQGLARAFMQPLLLAALAGVAIVLLRHPLIELALK
IVGGDEAVLEQARLFLEIRWLSAPAALANMVILGWLLGVQYVRAPVILLIVGNLLNIVLD
IWLVMGLGWNVQGAATATAISEYATLLLGLWLSWRVMRLRGISMPMLRTAWRGNLRRLLA
LNRDIMLRSLLLQLCFASLTIFGARLGGEVVAVNAVLMNLLTFTAYALDGFAYAVEAHSG
HAYGARDDSQLRKVWRAACRQACLVALAFGLVYAVAGQHIIAALTSLPELRALAGHYLPW
QVVLPLVGVWCYLLDGMFIGATRGAEMRNSMAVAAAGYGLTLLTVPVLGNHGLWLALAVF
LSLRGIALGWIWHRHRLRGTWFAADPTAHNETLS