Protein Info for IAI46_22980 in Serratia liquefaciens MT49

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04542: Sigma70_r2
  • amino acids 3 to 65 (63 residues), 33.6 bits, E=4.1e-12
• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 3 to 145 (143 residues), 62.2 bits, E=2.4e-21
• PF08281: Sigma70_r4_2
  • amino acids 92 to 144 (53 residues), 53.7 bits, E=2e-18
• PF04545: Sigma70_r4
  • amino acids 99 to 144 (46 residues), 35 bits, E=1.2e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 91% identity to spe:Spro_4455)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Protein Sequence (162 amino acids)

>IAI46_22980 RNA polymerase sigma factor (Serratia liquefaciens MT49)
MGQYLSRLWRYGLVLTHRRDVADDLVQATCVRALERAAQFAVGTRMDRWLFSILHSIWLN
EVRSQHIRQGQGFVDVDELAGAENGEQPIWANEVMQRVNQLPEAQRNTLFLVYVEELSYR
EAAEVLGVPIGTIMSRLAAARLRLANDSLLQTRTPQVKGEQS