Protein Info for IAI46_22865 in Serratia liquefaciens MT49

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 10 to 198 (189 residues), 190.7 bits, see alignment E=3e-60 PF08659: KR" amino acids 13 to 121 (109 residues), 39.2 bits, see alignment E=1.1e-13 PF13561: adh_short_C2" amino acids 19 to 248 (230 residues), 208.6 bits, see alignment E=1.7e-65

Best Hits

Swiss-Prot: 53% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 92% identity to spe:Spro_4437)

MetaCyc: 45% identical to A-factor type gamma-butyrolactone 6-reductase (6R-forming) (Streptomyces coelicolor A3(2))
1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.eb

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>IAI46_22865 3-oxoacyl-ACP reductase FabG (Serratia liquefaciens MT49)
MTTAHPLQNKVAFIQGGSRGIGAAIVKRLAREGATVAFTYVASAEKADALVAEITATGGK
ALAIKADSADAAALQQAVRQAVNSLGNLDILVNNAGVLAMGSTEELPLEDLDRTLAVNVR
SVFVASQEAARHMNDGGRIINIGSTNAERMPFAGGAVYAMSKSALVGLTKGMARDLGPRG
ITVNNVQPGPVDTDMNPASGDFAEQLKAMMAISRYGKDEEIASFVAYLAGPEAGYITGAS
LSIDGGFSA