Protein Info for IAI46_22825 in Serratia liquefaciens MT49

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details PF03788: LrgA" amino acids 30 to 122 (93 residues), 91.1 bits, see alignment E=1.8e-30

Best Hits

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_4533)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>IAI46_22825 CidA/LrgA family protein (Serratia liquefaciens MT49)
MLLAFRHAAPSLLNRLQVPIQVALYAVLFLIADRLVQQFHLPLPANIVGMLMLLALILLR
ILPLNWVKAGSRWLLAEMLLFFVPAVVAVVNYAQLLMVEGWKIFLVIAISTMLTLGATGL
VVDRVYRLEVWLQRRKQRDE