Protein Info for IAI46_22635 in Serratia liquefaciens MT49

Annotation: nucleoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 70% identical to IUNH_CRIFA: Inosine-uridine preferring nucleoside hydrolase (IUNH) from Crithidia fasciculata

KEGG orthology group: K01239, purine nucleosidase [EC: 3.2.2.1] (inferred from 96% identity to spe:Spro_4396)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

purine nucleotides degradation I (plants) (10/12 steps found)
adenosine nucleotides degradation I (7/8 steps found)
guanosine nucleotides degradation II (4/4 steps found)
superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
adenine and adenosine salvage II (2/2 steps found)
guanine and guanosine salvage II (2/2 steps found)
guanosine nucleotides degradation I (3/4 steps found)
superpathway of purines degradation in plants (13/18 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.1

Use Curated BLAST to search for 3.2.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>IAI46_22635 nucleoside hydrolase (Serratia liquefaciens MT49)
MKKIILDCDPGHDDAIAMLLAWGNPQIELLAVTTVVGNQTLDKVTRNALAVARIANITGV
PFAAGCPRPLVRQIEVAPDIHGESGLDGPVLPEPTLTLETRHAVDLIIDTIMAHPPGSVT
LVPTGGLTNIAMAVRKEPRIAERVKEVVLMGGGYHVGNWSAVAEFNIKIDPEAAHIVFNE
KWPLTMVGLDLTHQALATPEVCARIAAIQTGPARFVGELLEFFGKMYQQAQGFSAPPVHD
PCAVAYVIAPDVMTVRKVPVDIELTGTLTLGMTVADFRTAPPPDCHTQVAVTLDQDKFWG
LVVDALERIGDVKI