Protein Info for IAI46_22460 in Serratia liquefaciens MT49

Annotation: lipopolysaccharide ABC transporter substrate-binding protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03002: lipopolysaccharide transport periplasmic protein LptA
  • amino acids 27 to 166 (140 residues), 167 bits, E=1.1e-53
• PF03968: LptD_N
  • amino acids 38 to 148 (111 residues), 109.2 bits, E=7e-36

Best Hits

Swiss-Prot: 66% identical to LPTA_SHIFL: Lipopolysaccharide export system protein LptA (lptA) from Shigella flexneri

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 98% identity to spe:Spro_4365)

MetaCyc: 68% identical to LPS export ABC transporter substrate-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (179 amino acids)

>IAI46_22460 lipopolysaccharide ABC transporter substrate-binding protein LptA (Serratia liquefaciens MT49)
MKFKTNKPSRNLLIGSLILAASAPAWALKSDSNQPVSIDSLKQSLDMQSNVSTFTDNVVI
KQGTIDIKADKVVVTRPGGDQNKTYIEAFGNPVTFYQMQDSGKPVKGHAQKVRYDVASQL
VTLTGNAYLEQLDSNVKGDRITYLVQQQQMQAFSDKGKRVTTVLVPSQLQDKNGQNKSN