Protein Info for IAI46_22425 in Serratia liquefaciens MT49

Annotation: lipid asymmetry maintenance ABC transporter permease subunit MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 52 to 79 (28 residues), see Phobius details amino acids 87 to 118 (32 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 5 to 258 (254 residues), 350.7 bits, see alignment E=3e-109 PF02405: MlaE" amino acids 45 to 256 (212 residues), 251 bits, see alignment E=4.5e-79

Best Hits

Swiss-Prot: 83% identical to MLAE_ECOLI: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Escherichia coli (strain K12)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 96% identity to spe:Spro_4359)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>IAI46_22425 lipid asymmetry maintenance ABC transporter permease subunit MlaE (Serratia liquefaciens MT49)
MLFQALASLGRRGINTSASFGRAGLMLFNALVGRPEPRRQWPLLLKQLHSVGVQSLLIIV
VSGLFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPVVTALLFAGRAGSALTAEI
GLMKATEQISSLEMMAVDPLRRIVAPRFWAGLISMPLLTMIFVAIGIWGGSVVGVDWKGI
DSGFFWSAMQGAVEWKKDLLNCLIKSVVFAITVTWIAIFNGYDAVPTSEGISRATTRTVV
HSSLAVLGLDFVLTALMFGN