Protein Info for IAI46_22315 in Serratia liquefaciens MT49

Annotation: divisome-associated lipoprotein YraP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04972: BON" amino acids 46 to 113 (68 residues), 52.8 bits, see alignment E=2e-18 amino acids 124 to 189 (66 residues), 67.3 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 76% identical to YRAP_ECOLI: Uncharacterized protein YraP (yraP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_4339)

Predicted SEED Role

"21 kDa hemolysin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>IAI46_22315 divisome-associated lipoprotein YraP (Serratia liquefaciens MT49)
MKLKATFAVLSSALLLQGCIAGVVVGSAAVATKTATDPRSVGTQVDDGTLEARVENALSK
DQQLKKEARVVATAYQGKVLLTGQSPSTDLAARAKQIAMGVEGTTEVYNEIRQGTPVSLS
TASSDTWITTKVRSQLLTSDTVKSSNVKVTTENGEVFLLGLVTQQEGQSAAQIASQVSGV
KHVTTAFTFVK