Protein Info for IAI46_22260 in Serratia liquefaciens MT49

Annotation: phage holin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 53 to 79 (27 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details PF07332: Phage_holin_3_6" amino acids 22 to 130 (109 residues), 64.2 bits, see alignment E=5.6e-22

Best Hits

Swiss-Prot: 68% identical to YQJE_ECO57: Inner membrane protein YqjE (yqjE) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to srs:SerAS12_4435)

Predicted SEED Role

"Inner membrane protein YqjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>IAI46_22260 phage holin family protein (Serratia liquefaciens MT49)
MAEQQPQVRAQGPAKGVLDVGQRIITILVGMVETRVRLAVVELEEEKANLIQLLIMAGMT
LLFTAFGLMSLLILIFWAIDPIYRLMALGATTGVLLFLAVFGAIWTLVKARRSTLLGATR
KQLEIDRSELEDEK