Protein Info for IAI46_22240 in Serratia liquefaciens MT49

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF09335: SNARE_assoc" amino acids 48 to 172 (125 residues), 77.2 bits, see alignment E=8e-26

Best Hits

Swiss-Prot: 82% identical to YQJA_ECOL6: Inner membrane protein YqjA (yqjA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to srs:SerAS12_4431)

Predicted SEED Role

"DedA family inner membrane protein YqjA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>IAI46_22240 DedA family protein (Serratia liquefaciens MT49)
MDIIKELLHALWQQDFETLANPSLVWTLYVLLFMILFLENGLLPAAFLPGDSLLILVGVL
IAKGTMNFPLTILILTVAASLGCWVSYIQGKWLGNTRTVQGWLSHLPAHYHQRAHQLFHR
HGLSALLVGRFLAFVRTLLPTIAGLSGLSNARFQFFNWMSGLLWVVILTSLGFALGKTPV
FRKYEDQLMFCLMLLPLVLLVVGLVGSLIVLWRKKRADSQDQGKGA