Protein Info for IAI46_22210 in Serratia liquefaciens MT49

Annotation: serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 13 to 67 (55 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 359 to 374 (16 residues), see Phobius details PF00375: SDF" amino acids 13 to 393 (381 residues), 218.8 bits, see alignment E=6.2e-69

Best Hits

Swiss-Prot: 96% identical to SSTT_SERP5: Serine/threonine transporter SstT (sstT) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 96% identity to spe:Spro_4319)

MetaCyc: 80% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>IAI46_22210 serine/threonine transporter SstT (Serratia liquefaciens MT49)
MQNLLHRIVQGSLVKQIMIGLVAGIIVALISPAAASAVGLLGALFVGALKAVAPVLVLVL
VMASIANHKHGQKTNIRPILFLYLLGTFAAALVAVVVSFMFPSNLALVTGNADINPPGGI
IEVLKGLLMSVVANPFHALINANYIGILAWAVGLGLALRHASETTKSLINDMSHAVTLVV
RAVIRCAPLGIFGLVASTLADTGFGALWGYAQLLVVLIGCMLLVALVLNPLIVYWKIRRN
PYPLVFACLRESGVTAFFTRSSAANIPVNMELCKKLNLNEDTYSVSIPLGATINMAGAAI
TITVLTLAAVHTLGIPVDVPTALLLSVVAAICACGASGVAGGSLLLIPLACNMFGIPNDV
AMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACQAEDQRLADEDPLKVR