Protein Info for IAI46_22185 in Serratia liquefaciens MT49

Annotation: 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 201 to 371 (171 residues), 190.3 bits, E=6.6e-60
• PF06325: PrmA
  • amino acids 222 to 306 (85 residues), 25.5 bits, E=2.7e-09
• PF13847: Methyltransf_31
  • amino acids 232 to 317 (86 residues), 27.2 bits, E=9.3e-10
• PF13649: Methyltransf_25
  • amino acids 233 to 335 (103 residues), 29.8 bits, E=2.5e-10

Best Hits

Swiss-Prot: 94% identical to RLMG_SERP5: Ribosomal RNA large subunit methyltransferase G (rlmG) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 94% identity to spe:Spro_4312)

MetaCyc: 66% identical to 23S rRNA m2G1835 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11635 [EC: 2.1.1.174]

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172 or 2.1.1.174

Protein Sequence (379 amino acids)

>IAI46_22185 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG (Serratia liquefaciens MT49)
MSQLDLGTQQLELERYPQQEESTQLQAWEAADEYLLQQLENINIGDRPVLIFNDNFGTLA
CALHAHQPYSISDSYMSQLATRHNLKLNELDPEQVTLLDSLAELPASPAVVLIRIPKALA
LLEQQLRSLRNVVAPDTVIIAGAKARDVHTSTMQLFEKVLGPTRTSLAWKKARLIHCEVT
DIVPPAAPETTNWTLDGTDWLIHNHANVFSRSNLDIGARLFLEHLPKDLEGHIVDLGCGN
GVIGLTALAQNPQAQVTFVDESYMAVASSELNVEHNLPQDLDRCQFEVNNSLAGIERESV
QAVLCNPPFHQQHAITDHTAWQMFCDAKRCLQVGGELRIVGNRHLDYHHKLKRLFGNCTV
VASNKKFVILRAVKSGARY