Protein Info for IAI46_22035 in Serratia liquefaciens MT49

Annotation: zinc transporter ZupT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF02535: Zip" amino acids 7 to 91 (85 residues), 39.4 bits, see alignment E=2.3e-14 amino acids 94 to 244 (151 residues), 93.5 bits, see alignment E=7.6e-31

Best Hits

Swiss-Prot: 83% identical to ZUPT_ECO27: Zinc transporter ZupT (zupT) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 98% identity to spe:Spro_4285)

MetaCyc: 83% identical to divalent metal ion transporter ZupT (Escherichia coli K-12 substr. MG1655)
RXN0-10; RXN0-12; RXN0-16; TRANS-RXN-141A; TRANS-RXN-499; TRANS-RXN-8

Predicted SEED Role

"Zinc transporter ZupT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>IAI46_22035 zinc transporter ZupT (Serratia liquefaciens MT49)
MSVPLLLTLLAGGATFVGALFGIIGQKPSNRMLAFALGFAAGIMLLISLMEMLPAALHTV
GMSPMMGYGMFMLGLLGYFALDRMLPHQHPQDLMQQPLKPHNLKRTAVLLTLGISLHNFP
EGIATFVTASADLELGMGIALAVAIHNIPEGLAVAGPVYAATGSKTKALLWSGISGMAEI
LGGVLAFLLLGPMISPVVMASIMAAVAGIMVALSVDELMPLAKEIDPHNNPSYGVLCGMA
VMGFSLTLLQSGGIG