Protein Info for IAI46_22030 in Serratia liquefaciens MT49

Annotation: 4,5-DOPA dioxygenase extradiol

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02900: LigB
  • amino acids 9 to 256 (248 residues), 111.4 bits, E=2.2e-36

Best Hits

Swiss-Prot: 72% identical to YGID_ECOLI: 4,5-DOPA dioxygenase extradiol (ygiD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to srr:SerAS9_4391)

MetaCyc: 72% identical to 4,5-DOPA dioxygenase extradiol (Escherichia coli K-12 substr. MG1655)
Stizolobate synthase. [EC: 1.13.11.29]

Predicted SEED Role

"Uncharacterized protein ygiD"

MetaCyc Pathways

• betalamic acid biosynthesis (2/3 steps found)
• superpathway of betalain biosynthesis (14/27 steps found)

KEGG Metabolic Maps

• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.29

Protein Sequence (260 amino acids)

>IAI46_22030 4,5-DOPA dioxygenase extradiol (Serratia liquefaciens MT49)
MNSSRMPALFLGHGSPMNALEENRYTQAWRHLGETLPRPKAIIAVSAHWYTRGTAVTAME
KPRTIHDFGGFPQALFDTRYPAPGSPELAAQIQQVLAPITVTADDSEWGLDHGTWGVLIK
MYPEADIPIVQLSIDGTKPAEYHYELGRKLAVLRDQGVMIVASGNVVHNLRMVKWQGDAT
PYPWATSFDRFVRDNLNYQGDNHPLVNFMQHEGAALSNPTPEHYLPLLYVLGSWDGKEAI
TLPVEGIEMSALSMLSVQVG