Protein Info for IAI46_21845 in Serratia liquefaciens MT49

Annotation: nucleoside permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 1 to 407 (407 residues), 531.1 bits, see alignment E=3.8e-163 TIGR00889: nucleoside transporter" amino acids 1 to 409 (409 residues), 602.4 bits, see alignment E=2.5e-185 PF12832: MFS_1_like" amino acids 5 to 372 (368 residues), 92.1 bits, see alignment E=7.7e-30 PF01306: LacY_symp" amino acids 8 to 398 (391 residues), 37.1 bits, see alignment E=3.5e-13 PF07690: MFS_1" amino acids 248 to 414 (167 residues), 46.3 bits, see alignment E=6e-16

Best Hits

Swiss-Prot: 66% identical to XAPB_ECOLI: Xanthosine permease (xapB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to srr:SerAS9_4369)

MetaCyc: 66% identical to xanthosine:H+ symporter XapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-31

Predicted SEED Role

"Xanthosine permease" in subsystem Xanthosine utilization (xap region)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>IAI46_21845 nucleoside permease (Serratia liquefaciens MT49)
MAIKTRLKVMVFLQFFIWGAWLVTLGSYMINTLHFSGLQVGMVYSAKGVAALIMPGLAGI
LADRWIRANYLYALCHLFGALALYCAAQVEQPMVMFWVMLFNAMVYMPTISLSNAIAYFC
LEKHGYDTVKDFPPVRVYGTLGFIVAMWLIGFSRIELSNMQLYLASAVSLLLACYSLTLP
NCPTSKVEKSKSWFSVLGLDALVLFRQRRMALFFLFAMLLGAALQITNTFGNPFLHDFAS
NPLYQDSISVRYPAVLLSLSQISEVFFILTIPFFLRRYGIKQVMLISMAAWTLRFLFLAY
GTPVGFGFVLLLLSMIVYGCAFDFFNISGAIFVEKEADSRIRASAQGLFMTMVNGIGAYL
GAIASGEVVDFFTHDGVKDWQSIWLIFALYTLVLGIIFALTFNYQHRPEEYVGPVERAH