Protein Info for IAI46_21815 in Serratia liquefaciens MT49

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 413 to 436 (24 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 2 to 448 (447 residues), 358.7 bits, see alignment E=2.4e-111 PF00083: Sugar_tr" amino acids 8 to 451 (444 residues), 382.3 bits, see alignment E=3.6e-118 PF07690: MFS_1" amino acids 12 to 281 (270 residues), 87.1 bits, see alignment E=1.1e-28 amino acids 262 to 448 (187 residues), 38.4 bits, see alignment E=7.3e-14

Best Hits

KEGG orthology group: K03444, MFS transporter, SP family, sugar porter, other (inferred from 93% identity to spe:Spro_4230)

Predicted SEED Role

"sugar-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>IAI46_21815 sugar porter family MFS transporter (Serratia liquefaciens MT49)
MPYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAYFGITDPAQSGWAMSSALVGCIFGAV
ISGLLSDRFGRKLPLAIAALTFVISAWGTAVATSFDAFIIYRIVGGVGIGLASALSPVYI
AEISPAAQRGRFVAVNQLTIVIGVLAAQLINLLIADPVAANAGQAELLASWNGQVGWRYM
FGAELVPALAFLLLMLAVPESPRWLAKVGRHEQAQKVLRRIGNESYAQQTLKEIRHTLDK
DSGKVPLSALLRSDVRPVLVIGIVLAIFQQWCGINVIFNYAQEIFASAGFDINDTLKSIV
ATGLINLIFTLLALPLVDRIGRRRLMLIGACGLTVIYLLMAAAYAYGLLGLPVLLLVLVA
IAIYAVTLAPVTWVLLSEIFPNRIRGAAMAAGTFALWVACFVLTYSFPLLNAALGAAGSF
LLYGVICLAGAGFIYARVPETKGITLEALEEQLSAAGTDRAREKKFT