Protein Info for IAI46_21800 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 313 (264 residues), 132.9 bits, see alignment E=6.2e-43

Best Hits

Swiss-Prot: 82% identical to YPHD_ECOLI: Probable ABC transporter permease protein YphD (yphD) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 96% identity to spe:Spro_4227)

MetaCyc: 41% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Predicted sugar ABC transport system, permease protein YphD" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>IAI46_21800 ABC transporter permease (Serratia liquefaciens MT49)
MSTLVPEVKITRTRKLSKHANELGLLAIIVVLYLVFSIYATGFISLNNQMNILRDAATIG
IAAWAMTLIIISGEIDVSVGPMVAFISVILAYLMQYAIPLPFALILALCLGAALGSVAGV
LRGWFNVPSFVATLGLWSALRGMGLFMTNALPVPIDENDVLDWLGGQVLGLPVSAVIMLI
LFVVFQFISKKTAFGRSVYAIGGNASAAQLCGINVKRIRILLFTLAGLLAAVTGILLAAR
LGSGNAGAASGLEFDVIAAVVVGGTALSGGRGSMLGTLLGVLVITLIGNGLVLLGINSFF
QQVVRGVIIVLAVLANIIVMQKNNKQ