Protein Info for IAI46_21695 in Serratia liquefaciens MT49

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00356: LacI" amino acids 11 to 59 (49 residues), 57.8 bits, see alignment 1.5e-19 TIGR02417: D-fructose-responsive transcription factor" amino acids 11 to 337 (327 residues), 413.7 bits, see alignment E=2.9e-128 PF00532: Peripla_BP_1" amino acids 71 to 291 (221 residues), 37.6 bits, see alignment E=3.6e-13 PF13407: Peripla_BP_4" amino acids 74 to 272 (199 residues), 43.3 bits, see alignment E=6.9e-15 PF13377: Peripla_BP_3" amino acids 186 to 337 (152 residues), 50.9 bits, see alignment E=4.2e-17

Best Hits

Swiss-Prot: 68% identical to SCRR_KLEPN: Sucrose operon repressor (scrR) from Klebsiella pneumoniae

KEGG orthology group: K03484, LacI family transcriptional regulator, sucrose operon repressor (inferred from 99% identity to spe:Spro_4207)

Predicted SEED Role

"Sucrose operon repressor ScrR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>IAI46_21695 LacI family DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MPSVKKNKRITISDIAALAGVSKSTASLVLNGRSKEYRVSDDTRDRILALAGEHHYQPSF
HARSLRSSRSHTLGLVVPEMTNYGFAVISRELETLCREAGLQLLIACTDENPAQEMMAVN
SLVQRQVDGLIVASSQLNDAEYQKINASLPVVQMDRLITGSELPLVITDSLTSTATLVEN
VARQHPDEFYFLGGQPRISPTRDRLAGFQLGLERAGVACKPEWIINGNYHPSSGYEMFAQ
LCAQLGRPPKALFTAACGLLEGVLRYLNQHQLMESDLHLCSFDDHYLFDGLTLKIDTVAQ
DCRALAQHSFDMVSALIDERPLEQNALYLPGNIHWRHAGSKALLGQP