Protein Info for IAI46_21670 in Serratia liquefaciens MT49

Annotation: ShlB/FhaC/HecB family hemolysin secretion/activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF08479: POTRA_2" amino acids 86 to 162 (77 residues), 85.8 bits, see alignment E=2.2e-28 PF17287: POTRA_3" amino acids 164 to 217 (54 residues), 62.5 bits, see alignment 3e-21 PF03865: ShlB" amino acids 222 to 535 (314 residues), 376.5 bits, see alignment E=1.9e-116

Best Hits

Swiss-Prot: 69% identical to CDIB_YERPE: Outer membrane transporter CdiB (cdib) from Yersinia pestis

KEGG orthology group: None (inferred from 96% identity to srs:SerAS12_4347)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>IAI46_21670 ShlB/FhaC/HecB family hemolysin secretion/activation protein (Serratia liquefaciens MT49)
MRHSAYSSLGLAVRKGCIPFGYVVLPLFIFSQPLLAATSNSEQLIIQQQRQKALEQQLTP
PTPDVRLSPPSSSFGRIAFPQEKPCFPIDQVELSGQDKLPHWLPLQRIANQAQGRCLGGQ
GINLLMSTLQNRLVDHGYITTRVLAPTQDLKSGKLRLVVVPGYVRQVKLTPDSGHYIQPY
SSFPAHAGNLLDLRDIEQGLENLQRLPTVQANMEIIPGEQPGESDIALSWKQERMWRIGA
SLDDSGTKSTGRYQGGLTLSLDNPFSLSDLFYISGSTDLQNQGGKGSKNITGHYSVPFGY
WMAGVTANSYDYHQTIAGQNQDYRYSGKSKNLDFQLSRVLHRNGSQKTTLTYDVLARESS
NYINDTEVEVQRRRTSGWRLGLQHRHYIQQATLDAGVSYQRGTRWFGALPAPEETFGEAT
ALSKIVQLNAQLDVPFSLFSQNFRYNVQYQRQISDTPLTPQDQFAIGNRWTVRGFDGERT
LNANHGWFVRNDLAWRTPLQGQELYLGADYGEVGGYGSDYLVGQHLAGGVVGLRGYAFKV
GYDLFAGVPFSKPEGFSTSPVTLGFNLSWNY