Protein Info for IAI46_21630 in Serratia liquefaciens MT49

Annotation: SMI1/KNR4 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF14567: SUKH_5" amino acids 7 to 148 (142 residues), 70.9 bits, see alignment E=1.5e-23 PF09346: SMI1_KNR4" amino acids 27 to 146 (120 residues), 52.1 bits, see alignment E=1.5e-17 PF14568: SUKH_6" amino acids 29 to 146 (118 residues), 70.7 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 40% identity to bcl:ABC1195)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>IAI46_21630 SMI1/KNR4 family protein (Serratia liquefaciens MT49)
MSLNDMKNAIDIINGKIDEADFDGPKDDALIKSAEKVLGLSFPITYRFFLENLGCGDIAG
QEFYGLIKSDFFNSSVPDAVWITIQERNNSNLPDNYIIVSATGDGDYVVLDCAQSGSEAP
VKLWSPGVNDHQLAFKPLANDFGEFFYKQMQSIS