Protein Info for IAI46_21575 in Serratia liquefaciens MT49

Annotation: queuosine precursor transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 79 to 98 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 89 to 280 (192 residues), 100.3 bits, see alignment E=6.5e-33 PF02592: Vut_1" amino acids 116 to 272 (157 residues), 136.2 bits, see alignment E=6.1e-44

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 97% identity to spe:Spro_4196)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>IAI46_21575 queuosine precursor transporter (Serratia liquefaciens MT49)
MEPNQKFKLLGFTRHGTLAANVMILATGKTITMGLNELADSEISEDLSRHELQALYRKIY
GNNQQQTAYELSDRHERSWYAYLIITVALSVIYIFSTLCGVKPIQIPALNLITPPAIFIY
PLTFILVDILNEFYGLRLARRTIIISFMANLIFVLGVWVTTLVPSIPQWEFSKTYDGIVH
SIMAVLVASSAAYLISENVNSYLLCKIKELTNSRYLFVRVITSTVVASAIDSVVFCTLAF
YNVLSWDIIKTMILSQFLIKVVYALVGVGPIYAARSLFNRYINTDHARSNEYAYQKTR