Protein Info for IAI46_21525 in Serratia liquefaciens MT49

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 17 to 558 (542 residues), 753.5 bits, see alignment E=6.6e-231 PF00664: ABC_membrane" amino acids 28 to 281 (254 residues), 46.4 bits, see alignment E=4.4e-16 PF00005: ABC_tran" amino acids 350 to 497 (148 residues), 104.3 bits, see alignment E=8.8e-34

Best Hits

Swiss-Prot: 57% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12536, ATP-binding cassette, subfamily C, bacterial HasD (inferred from 67% identity to spe:Spro_1596)

Predicted SEED Role

"ABC-type protease exporter, ATP-binding component PrtD/AprD" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>IAI46_21525 type I secretion system permease/ATPase (Serratia liquefaciens MT49)
MQFVELFQPNEIVNAVRQHRRAFWSLGCFTAVINILMLVPSLYMLQVYDRALPSGNGMTL
LMLTLIVLFLFIMMGVFEYVRSMMVIRIGKQLDATLNDRIYTAAFEANLRNNATDAGQML
GDLTTVRQFLTGSALFAFFDAPWFPIYLLVIFLFNGWLGLFALAAVLLLIALAVLNQVKT
NEPLAMASRFSIESGIAASTGLRNAEVIEAMGMLPALRQRWKSLHSRFLDAQRIASERAA
NIGAVTKVVRIALQSLVLGLGGWLAIDGHISAGMMIAGSILLGRTLAPIEQVINVWKSWS
SAKLAYLRLVKLLDASPPRILGMSLPRPQGRLRVEQIAAGTPAAPTSLILQGIDFQLAPG
EVLGVIGASGSGKSTLARLLVGIWPVTEGHIRLDDADIFQWNKDQLGSAIGYLPQDIELF
AGTVAENIARFQEVNPQKVLTAAKLAGVHELILHFPAGYDTVLGHAGNGLSGGQKQRIAL
ARALYDDPVMLVLDEPNANLDETGELALNQAIMQLRTAGKTIVLISHRPQLIATTTHLLL
LDGGSMRAFGPTSKVIAAMQQVQRQQPAVNHRPEEMPDGTA