Protein Info for IAI46_21415 in Serratia liquefaciens MT49

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 5 to 100 (96 residues), 77.4 bits, E=1.1e-25
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 6 to 269 (264 residues), 254 bits, E=9.2e-80
• PF14748: P5CR_dimer
  • amino acids 164 to 269 (106 residues), 108.1 bits, E=2.6e-35

Best Hits

Swiss-Prot: 67% identical to P5CR_VIBAL: Pyrroline-5-carboxylate reductase (proC) from Vibrio alginolyticus

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 94% identity to spe:Spro_4031)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (2/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (273 amino acids)

>IAI46_21415 pyrroline-5-carboxylate reductase (Serratia liquefaciens MT49)
MQHRKITFIGAGNMARAIIAGLVAGGYPAKSISVCAPSAKNRDALAADYGIVSSGDNLAC
AREADVIVLAVKPQMMADVCQPLRDQIDFSGKLVLSIAAGIQVSRFYQLLADNLNIVRIM
PNTPSLVGKGMSGLYAPQQVSQQDRDYTSDLMASVGKVCWVDDENGINSVIAAAGSAPAY
FFLFMEAMQQEAERMGFDSQTARALVQQAASGAAALVEANPETPLSTLREQVTSKGGTTA
EALRVFNEQQLPATVAKAMQAAVSRAQEMEKSF