Protein Info for IAI46_21280 in Serratia liquefaciens MT49

Annotation: multicopper oxidase CueO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 28 (26 residues), 20.4 bits, see alignment (E = 2.5e-08) PF07732: Cu-oxidase_3" amino acids 53 to 167 (115 residues), 106 bits, see alignment E=2.1e-34 PF07731: Cu-oxidase_2" amino acids 425 to 539 (115 residues), 89.5 bits, see alignment E=2.7e-29

Best Hits

Swiss-Prot: 72% identical to CUEO_YERPE: Blue copper oxidase CueO (cueO) from Yersinia pestis

KEGG orthology group: K14588, blue copper oxidase (inferred from 95% identity to spe:Spro_3999)

Predicted SEED Role

"Blue copper oxidase CueO precursor" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>IAI46_21280 multicopper oxidase CueO (Serratia liquefaciens MT49)
MLRRDFIKLTAALGAASALPLWSRGAWAAELPALPIPPLLMPDAQGNIALALQTGEVNWL
PGKATQTWGFNGALLGPAVRLQRGKPVTVDIRNALPEASTVHWHGLEIPGDVDGGPQALI
QPGATRRVQFTIEQPAATCWFHPHTHGKTGQQVMKGLAGLVLLEDDESSKLPLPKTWGQD
DIPVILQDKRLGKDAQIEYQLDVMSAAVGWFGDRMFTNGAQYPRHVAPRGWLRLRFLNGC
NARSLNLAASDNRPLYVIASDGGFLAEPVKLTELPMLMGERFEVLVDASDGKAFDIVTLP
VKQMGMTLAPFDQPLPVLHIQPSLAQGIKTMPDSLVKLPALPAVTGIQERWLQLMMNPQL
DKLGMQALMDRYGHQAMAGMSMDHGGMGKGDSGDMSGMQGMDHGSMKGMDHGNMKGMDHG
AKPFDFSHGNMINGKAFDMTKPMFEAKRGKYEKWTLSGEGDMMLHPFHIHGTQFRILSEN
GKPPAAHRSGWKDTVRVEGWRSEVLVRFDHLANSDHAYMAHCHLLEHEDTGMMMGFTVAD