Protein Info for IAI46_21245 in Serratia liquefaciens MT49

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00018: pantoate--beta-alanine ligase
  • amino acids 1 to 280 (280 residues), 374.5 bits, E=2.6e-116
• PF02569: Pantoate_ligase
  • amino acids 3 to 278 (276 residues), 348.8 bits, E=8.7e-109

Best Hits

Swiss-Prot: 94% identical to PANC_SERP5: Pantothenate synthetase (panC) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_4199)

MetaCyc: 73% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Protein Sequence (284 amino acids)

>IAI46_21245 pantoate--beta-alanine ligase (Serratia liquefaciens MT49)
MVIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEARARADVVVVSIFVNPM
QFERPDDLARYPRTLQEDSEKLTRRGVELVFAPAPADIYPQGLEQQTYVDVPGLSSILEG
ASRPGHFRGVATIVSKLFNLVQPDLACFGEKDYQQLALIRKMVADMGYDIDIVGVPTVRA
KDGLALSSRNGYLTAEERKIAPQLSKIMNALAEQLSNGERHVDELLEHSAAQLRSAGFTP
DELFIRDADSLQPLGVESQRAVVLMAAWLGKARLIDNQQVDLTL