Protein Info for IAI46_21200 in Serratia liquefaciens MT49

Annotation: RNA 2',3'-cyclic phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02258: 2'-5' RNA ligase
  • amino acids 6 to 174 (169 residues), 125.6 bits, E=1.1e-40
• PF02834: LigT_PEase
  • amino acids 12 to 89 (78 residues), 50.5 bits, E=2e-17
• PF13563: 2_5_RNA_ligase2
  • amino acids 14 to 137 (124 residues), 46.8 bits, E=3.4e-16

Best Hits

Swiss-Prot: 63% identical to THPR_ECOLI: RNA 2',3'-cyclic phosphodiesterase (thpR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_4190)

MetaCyc: 63% identical to RNA 2',3'-cyclic phosphodiesterase (Escherichia coli K-12 substr. MG1655)
6.5.1.-; RXN-15952 [EC: 3.1.4.58]

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.58

Protein Sequence (180 amino acids)

>IAI46_21200 RNA 2',3'-cyclic phosphodiesterase (Serratia liquefaciens MT49)
MSSSRRLFFALTLPDALQQQVIRWRADAFTPEAGRPVAAANLHLTLAFLGDVTAQKETAL
KKLAGRISQPGFSMVLDDLGHWPRPGVVWLGTRRAPRGLLQLAELLRSQAARSGCYQSPM
PFHPHITLLRSATQPVAIPPATPGWHFSANEFALYQSVFENGRTRYQMLEQWPLAPQDTP