Protein Info for IAI46_21185 in Serratia liquefaciens MT49

Annotation: ferrichrome porin FhuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF07715: Plug" amino acids 84 to 187 (104 residues), 99.4 bits, see alignment E=1.7e-32 TIGR01783: TonB-dependent siderophore receptor" amino acids 86 to 732 (647 residues), 520.9 bits, see alignment E=3e-160 PF00593: TonB_dep_Rec" amino acids 260 to 701 (442 residues), 236.8 bits, see alignment E=9.3e-74

Best Hits

Swiss-Prot: 41% identical to FOXA_SALTS: Ferrioxamine B receptor (foxA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 94% identity to spe:Spro_3979)

Predicted SEED Role

"Ferric hydroxamate outer membrane receptor FhuA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>IAI46_21185 ferrichrome porin FhuA (Serratia liquefaciens MT49)
MSTKRLPSAAKQSRSHVSGLAMTIAAALGTLAMPAFSADTKSAAKEETLTVVGSSQSQQE
NAWGPVGTYAAKHSATGTKTDTPIEKTPQSVSVVTREEMDMRQPDTVKGALAYTPGVMVG
NRGASTAYDAVNIRGFSSVGTNMYLDGLKLQDDNYSIYQIDPYFLERAEVLRGPSSVLYG
KSNPGGVVALVSKRPTTETLREVQFKMGTDNLFQTGFDFGGALDDDGIYSYRLTGLARDE
DQQQVGEKSKRYAIAPSFSWRPDDRTSLTFLSSFQDDPSVGFYGWLPKEGTVQNGINGKL
PTSFNDGEPGYNNISRKQQMVGYAFEHGFDDVWTLRQNLRYSKMDVDYRSIYGQGISATN
PAELTRGVMNSKEHLSSFAVDTQAQAKFATAAVDHTLLMGVDYMRMRNDVVYQYGSASSL
NVVAPQYGNQSYTITGGASQVNRQEQTGLYVQDQAEWNNWVLTMGGRYDWSDTNSTNRLK
QNLVSKQKDNEFTGRAGLNYVFENGIAPYVSYSESFEPTSGTDFSGNTFAASKGKQYEAG
VKFAPKDRPITASIAIYQLTKTNNKVADPDPDHSFASVLGGEIRSRGVELEGKAALTANV
NLLGSYTYTDAEYTKDTTLQGNTPAAIPKHMASVWADYTFHETALSGLTLGSGVRYVGSS
YGDEANTFKVKDYTVVDAAIKYDLARFNLPGSSIGINVNNLFDKEYVSSCFATYGCYWGA
ERQVVATATFRF