Protein Info for IAI46_21135 in Serratia liquefaciens MT49

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 23 to 298 (276 residues), 360.7 bits, E=3.1e-112
• PF00491: Arginase
  • amino acids 34 to 297 (264 residues), 302.9 bits, E=1.2e-94

Best Hits

Swiss-Prot: 96% identical to SPEB_SERP5: Agmatinase (speB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 97% identity to srs:SerAS12_4178)

MetaCyc: 88% identical to agmatinase (Escherichia coli K-12 substr. MG1655)
Agmatinase. [EC: 3.5.3.11]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• superpathway of polyamine biosynthesis I (8/8 steps found)
• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11

Protein Sequence (306 amino acids)

>IAI46_21135 agmatinase (Serratia liquefaciens MT49)
MSTLGHQPDNSLVSNAFGFLRFPLNFMPYDSDAEWVITGIPFDMATSGRAGGRHGPAAIR
QVSTNLAWEGNRWPWNFDLRDRLNVVDCGDVVFNFGDAQDMSDKLQAHAEKLLKAGKRML
SFGGDHFVTLPLLRAHAKHFGKLALVHFDAHTDTYANGSQYDHGTMFFHAPNEGLIDPTR
SVQIGIRTEFDHDNGFTVLDAAQVNDRSVDDLLAQIKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRALKLVRGMQSLNIVGMDVVEVAPAYDQSEITALAAATLGLEMLYLQ
AAKKTK