Protein Info for IAI46_21090 in Serratia liquefaciens MT49

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF07992: Pyr_redox_2" amino acids 9 to 299 (291 residues), 190.4 bits, see alignment E=1.9e-59 PF00070: Pyr_redox" amino acids 149 to 210 (62 residues), 56.4 bits, see alignment E=1.5e-18 PF13450: NAD_binding_8" amino acids 152 to 186 (35 residues), 24.3 bits, see alignment 1.2e-08 PF14759: Reductase_C" amino acids 320 to 402 (83 residues), 71.2 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 94% identity to spe:Spro_3963)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>IAI46_21090 FAD-dependent oxidoreductase (Serratia liquefaciens MT49)
MSQPEAAGIVIIGGGQAGGWAAKTLRDRGYAGRLTVISDEPYDFYERPPLSKAALLDGEA
PLSRLFSEQVVAGLNLNWCRPLRAESIDAKKQIVSLSDGRQLQFDQLLIATGGRPRLPDA
RWASHPRVMTLRSWDDAAKLRQALQGCRRLAIVGGGWIGLEIAASARRLGADVTVFERQP
ALCMRSVGADVSQALLELHQQQGVTLHCGCGDIQLEDRDGSAWIGSGVSDPQPFDLVVVG
IGVELNLELARSAGLKIDVGIVVDGQGRTSHPAIFAAGDVARHPTLGLCLQSWAYAQNQA
ISTACAMLDAFAAPYDDVAWLWSDQYDANIQILGVPTGGVHHVVRRTPQSQVFFTLNADR
QLVQMVAFNDARTIKLGKRWLASGRVLEPQQLADAEFSLMALK